PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00816g08011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 248aa    MW: 27878 Da    PI: 7.5542
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00816g08011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1049.6e-3350107260
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                               ++vrY+eClkNhA+ +Ggha+DGCg+fmp+ ge+gt++alkCaAC+CHRnFHR+eve e
  Peinf101Scf00816g08011.1  50 STVRYRECLKNHAVGIGGHATDGCGDFMPA-GEDGTMDALKCAACNCHRNFHRKEVEGE 107
                               689**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2252109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-2952104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.1E-3053104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.85654103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.38E-21170246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-32174247IPR009057Homeodomain-like
TIGRFAMsTIGR015655.6E-26185241IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEFDEHEEHE EEIGIQNIPA VTGNNYQTQG NSVRVGSEEG LNSTGVRKSS TVRYRECLKN  60
HAVGIGGHAT DGCGDFMPAG EDGTMDALKC AACNCHRNFH RKEVEGEVVL HTPPPHLTHH  120
HQPHHTHHPQ FSPFSSYRTP HHPSGYLHVT PPPHQRPLAL PSTSREDEDM SNPSSSGGGG  180
VGSSRKRFRT KFTQEQKDKM LAFAERLGWR MQKQDEEAVQ QFCAETNVKR HVFKVWMHNN  240
KLTLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-261862411873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9281329e-77CU928132.3 S.lycopersicum DNA sequence from clone SL_MboI-49I21 on chromosome 4, complete sequence.
GenBankHG9755169e-77HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016501975.11e-113PREDICTED: uncharacterized protein LOC107820239
SwissprotQ6YXH52e-75ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1AZE87e-99M1AZE8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000336242e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-69homeobox protein 22